Chemicals

Tromethamine Tris Buffer Is A Buffer Salt Widely Used In The Field Of Biomedicine. AVT Has Newly Launched Tromethamine (TRIS). NMPA And US FDA Registration In Progress. The Product Advantages Including High Purity, Low Impurities, Production In Accor ...Read More

The Last Price Cut Before The Spring Festival, If Needed To Seize The Opportunity. The Last Price Cut Before The Spring Festival, If Needed To Seize The Opportunity. If You Want To Know Any Details, Please Click On Our €�products & Services” Page. ...Read More

Gomez Chemical Is A China Factory that Produce Cellulose HPMC/ HEMC/ HEC and RDP for Many Years. We Provide construction-grade chemical Products, It's A Good Match For Your Business. We Are A Professional Manufacturer Of Cellulose Ether ...Read More

Gomez Chemical Is A China Factory that Produce Cellulose HPMC/ HEMC/ HEC and RDP for Many Years. We Provide construction-grade chemical Products, It's A Good Match For Your Business. We Are A Professional Manufacturer Of Cellulose Ether ...Read More

Gomez Chemical Is A China Factory that Produce Cellulose HPMC/ HEMC/ HEC and RDP for Many Years. We Provide construction-grade chemical Products, It's A Good Match For Your Business. We Are A Professional Manufacturer Of Cellulose Ether ...Read More

Classification: Pharmaceutical Intermediates Cas NO.: 168555-66-6 Molecular Formula: C18H19Na2O8P Melting Point: 238-242 °C Boiling Point: 611.8 °C at 760 mmHg Stability: null Refractive index: Flash Point: 611.8 °C at� ...Read More

Xanthan Gum In Food Applications Do You Know The Uses Of Xanthan Gum In The Food Industry? Food Grade Xanthan Gum, Also Known As E415 Food Additive, Xanthan Gum E 415, Thickener/stabilizer E415, Can Be Used In Milk Drinks, Yogurt, Sausage, Cans, Fro ...Read More

Do You Know The Uses Of Xanthan Gum In The Food Industry? Food Grade Xanthan Gum, Also Known As E415 Additive, Xanthan Gum E 415, Thickener/stabilizer E415, Can Be Used In Milk Drinks, Yogurt, Sausage, Cans, Frozen Food, Juices, And Juice-containing ...Read More

Click The Links Above To Purchase Xanthan Gum Cosmetics, Xanthan Gum Hand Sanitizer, Etc.! Products Catalog Xanthan Gum Gellan Gum Welan Gum DSTA Gum All Products ? Application Food Applications Health, Personal Care & Cosmetic Applicatio ...Read More

Xanthan Gum Pharmaceutical Uses/applications Are As Follows: Pharmaceutical Excipient Xanthan Gum Was Included In The Chinese Pharmacopoeia As A Pharmaceutical Excipient In 2010. Compared With Other Gums And Suspending Agents, Pharmaceutical Gr ...Read More

Application Of Zibozan® Xanthan Gum In Drilling, Workover, And Completion Deosen Zibozan® Oil Drilling Grade Xanthan Gum Is An Efficient, High-quality, And Environmentally Friendly Oil Drilling Mud Additive With A Wide Range Of Applications. It ...Read More

ASIC3 Channels, APETx2 Inhibits ASIC3 Channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAT.#: O1040-V CAS N0.: 713544-47-9 Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide Bonds Between Cys4-Cys37, Cys6-Cys30 And Cys20-Cy ...Read More

Peptide Api, Peptide Apis The Biological Activity Of Peptide Is Extensive And Important, And It Can Act On Endocrine System, Digestive System, Cardiovascular System And So On. Although The History Of Peptide As Pharmaceuticals Is Relatively Short, I ...Read More

L-type Ca2+ Channels. Calcicludine Is A Potent And Specific Antagonist Of Neuronal L-type CaV Channels1. SPECIFICATION OF CALCICLUDINE Product Name: Calcicludine (Calcicludine, L-type Ca2+ Channel Blocker) CAT.#: C1020-V CAS N0.: 178037-96-2 ...Read More

Potent, Specific L-type Ca2+ Channel Blocker (IC50 = 15 NM). Inactive On Other Voltage-dependent Ca2+ Channels. Smooth Muscle Relaxant And Cardiac Contraction Inhibitor. Neurotoxic. Active In Vivo And In Vitro. SPECIFICATION OF CALCISEPTINE Pro ...Read More

Classification: Vitamins, Amino Acids And Coenzymes Cas NO.: 121062-08-6 Molecular Formula: C50H69N15O9 Melting Point: Boiling Point: Stability:. Null Refractive Index:1 .669 Flash Point: Purity: 98.0%min Appearance. Solid Usage: Amino Acid ...Read More

Classification: Agrochemicals Cas NO.: 112-89-0 Molecular Formula: C18H37Br Melting Point: 20-23? Boiling Point: 214-216? (12 MmHg) Stability: Stable Under Normal Temperatures And Pressures. Refractive Index:1.462-1.464 Flash Point: 91 C Puri ...Read More

Direct Dye Sky Blue 5B Direct Blue 15 For Textile Dye CAS No. 2429-74-5 Other Names DIRECT BLUE 15, DIRECT FAST BLUE 5B MF C34H24N6NA4016S4 EINECS No. 219-385-3 Place Of Origin Hebei, China (Mainland) Type Direct Dye Usage Ink Dyestuffs, Pap ...Read More