Chemicals

ASIC3 Channels, APETx2 Inhibits ASIC3 Channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAT.#: O1040-V CAS N0.: 713544-47-9 Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide Bonds Between Cys4-Cys37, Cys6-Cys30 And Cys20-Cy ...Read More

Peptide Api, Peptide Apis The Biological Activity Of Peptide Is Extensive And Important, And It Can Act On Endocrine System, Digestive System, Cardiovascular System And So On. Although The History Of Peptide As Pharmaceuticals Is Relatively Short, I ...Read More

L-type Ca2+ Channels. Calcicludine Is A Potent And Specific Antagonist Of Neuronal L-type CaV Channels1. SPECIFICATION OF CALCICLUDINE Product Name: Calcicludine (Calcicludine, L-type Ca2+ Channel Blocker) CAT.#: C1020-V CAS N0.: 178037-96-2 ...Read More

Potent, Specific L-type Ca2+ Channel Blocker (IC50 = 15 NM). Inactive On Other Voltage-dependent Ca2+ Channels. Smooth Muscle Relaxant And Cardiac Contraction Inhibitor. Neurotoxic. Active In Vivo And In Vitro. SPECIFICATION OF CALCISEPTINE Pro ...Read More

Classification: Vitamins, Amino Acids And Coenzymes Cas NO.: 121062-08-6 Molecular Formula: C50H69N15O9 Melting Point: Boiling Point: Stability:. Null Refractive Index:1 .669 Flash Point: Purity: 98.0%min Appearance. Solid Usage: Amino Acid ...Read More

Classification: Agrochemicals Cas NO.: 112-89-0 Molecular Formula: C18H37Br Melting Point: 20-23? Boiling Point: 214-216? (12 MmHg) Stability: Stable Under Normal Temperatures And Pressures. Refractive Index:1.462-1.464 Flash Point: 91 C Puri ...Read More

Direct Dye Sky Blue 5B Direct Blue 15 For Textile Dye CAS No. 2429-74-5 Other Names DIRECT BLUE 15, DIRECT FAST BLUE 5B MF C34H24N6NA4016S4 EINECS No. 219-385-3 Place Of Origin Hebei, China (Mainland) Type Direct Dye Usage Ink Dyestuffs, Pap ...Read More

Anethole Package As Request. We're The Producer And Exporter Of Kinds Aroma Chemicals. It Includes Musk Ambrette, Musk Xylol, Musk Ketone. Besides, We Also Trade Many Others: Ginger Oil Aniseed Oil Cedarwood Oil Benzyl Benzoate Benzyl Aceta ...Read More

Eucalyptus Oil Package As Requested. We're The Producer And Exporter Of Kinds Aroma Chemicals. It Includes Musk Ambrette, Musk Xylol, Musk Ketone. Besides, We Also Trade Many Others: Ginger Oil Aniseed Oil Cedarwood Oil Benzyl Benzoate Benz ...Read More

Cewarwood Oil Package As Requested. We're The Producer And Exporter Of Kinds Aroma Chemicals. It Includes Musk Ambrette, Musk Xylol, Musk Ketone. Besides, We Also Trade Many Others: Ginger Oil Aniseed Oil Cedarwood Oil Benzyl Benzoate Benzy ...Read More

Aniseed Oil Package:50kgs/Drum We're The Producer And Exporter Of Kinds Aroma Chemicals. It Includes Musk Ambrette, Musk Xylol, Musk Ketone. Besides, We Also Trade Many Others: Ginger Oil Aniseed Oil Cedarwood Oil Benzyl Benzoate Benzyl Ace ...Read More

RUBBER ACCELERATOR MBT Chemical Name:2-Mercaptobenzothiazole Molecular Formula:C7H5NS2 Molecular Weight: 167.25 CAS NO.: 149-30-4 EINECS NO.: 205-736-8 Specification: Appearance Gray- White Or Light Yellow Powder Initial M.P. OC= 171.0 H ...Read More

As A Professional Plant Extract Supplier/company, Kindarco Supplies Different Types Of Crude Plant Extracts Including Citrus Aurantium Extract, Sophora Japonica Extract, And Other Plant Based Extracts. After Years Of Development And Endeavours, Cheng ...Read More

Ginger Oil 50kgs Drum, Or As Clients' Request. We're The Producer And Exporter Of Kinds Aroma Chemicals. It Includes Musk Ambrette, Musk Xylol, Musk Ketone. Besides, We Also Trade Many Others: Ginger Oil Aniseed Oil Cedarwood Oil Benzyl Benz ...Read More

Wickr:Dianahappy WhatsApp:+447835009600 Email:diana447835009600@gmail.com We Offer Discreet Package And Fast Shipment Within 24hours,using Couriers,DHL,TNT,FEDEX,UPS,EMS. 6CL-ADB-A Wickr:Dianahappy WhatsApp:+447835009600 CAS 13605-48-6 Whats ...Read More

Wickr:Dianahappy WhatsApp:+447835009600 Email:diana447835009600@gmail.com We Offer Discreet Package And Fast Shipment Within 24hours,using Couriers,DHL,TNT,FEDEX,UPS,EMS. 6CL-ADB-A Wickr:Dianahappy WhatsApp:+447835009600 CAS 13605-48-6 Whats ...Read More

Wickr:Dianahappy WhatsApp:+447835009600 Email:diana447835009600@gmail.com We Offer Discreet Package And Fast Shipment Within 24hours,using Couriers,DHL,TNT,FEDEX,UPS,EMS. 6CL-ADB-A Wickr:Dianahappy WhatsApp:+447835009600 CAS 13605-48-6 Whats ...Read More

Wickr:Dianahappy WhatsApp:+447835009600 Email:diana447835009600@gmail.com We Offer Discreet Package And Fast Shipment Within 24hours,using Couriers,DHL,TNT,FEDEX,UPS,EMS. 6CL-ADB-A Wickr:Dianahappy WhatsApp:+447835009600 CAS 13605-48-6 Whats ...Read More