Place of Origin :
Post Date : 25-10-2021
Expiry Date : 31-12-2022
Potent, Specific L-type Ca2+ Channel Blocker (IC50 = 15 NM). Inactive On Other Voltage-dependent Ca2+ Channels. Smooth Muscle Relaxant And Cardiac Contraction Inhibitor. Neurotoxic. Active In Vivo And In Vitro.
SPECIFICATION OF CALCISEPTINE
Product Name: Calciseptine (Calciseptine, L-type Ca2+ Channel Blocker)
CAT.#: C1010-V
CAS N0.: 178805-91-9
Sequence: MRICYIHKASLPRATKTCVENTCYKMFIRTQREYISERGCGCPTAMWPYQTECCKGDRCNK (Modifications: Disulfide Bonds: 4-23, 18-40, 42-53, 54-59)
Purity: > 98%(HPLC)
Solubility: Soluble In Water
Form/State: Lyophilized Powder
Molecular Weight: 7167.40
Molecular Formula: C304H477N91O88S11
Source: Chemical Synthesis
Shipping And Storage: Shipped At Room Temperature. The Product, As Supplied, Can Be Stored Intact At Room Temperature For Several Weeks. For Longer Periods, It Should Be Stored At -20°C.
Storage Of Solutions: Up To Two Weeks At 4°C Or Three Months At -20°C.
APPLICATION OF CALCISEPTINE
Calciseptine Is A Natural Peptide Consisting Of 60 Amino Acids With Four Disulfide Bonds. The Peptide Is A Ca2+ Channel Blocker, Has Agonist Actions On L-type Ca2+ Currents Of Frog And Mammalian Skeletal Muscle.
KS-V Peptide Provides One-stop Services For Drug R&D. Leveraging The Technical Advantages In The Field Of Structure-Based Drug Discovery (SBDD) And Chemistry(Medicinal Chemistry And Peptide Synthesis), KS-V Peptide Provides Leading CRO Drug Discovery Services And CMC Services To Global Biopharmaceutical Clients. Apart From This, KS-V Peptide Also Provides High-end Biological Reagents And Raw Materials And Difficult Peptides, Such As Post-translational Histones And Nucleosome Assembly, Ubiquitins And Ubiquitin Probes, Toxins And Analogues, Modification And Optimization Of Pharmaceutical Peptide And Development Of Professional Peptide Technology For Pharma, Biotechs, And Universities Around The World. More Information About Our Peptide Chemical Structure Identification, Contact Us.