Place of Origin : 
Post Date : 25-10-2021
Expiry Date : 31-12-2022

ASIC3 Channels, APETx2 Inhibits ASIC3 Channels1

SPECIFICATION OF APETX2

Product Name: APETx2
CAT.#: O1040-V
CAS N0.: 713544-47-9
Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide Bonds Between Cys4-Cys37, Cys6-Cys30 And Cys20-Cys38)
Purity: > 98%
Solubility: Soluble In Water
Form/State: Lyophilized Powder
Molecular Weight: 4561 Da
Molecular Formula: C196H280N54O61S6
Source: Synthetic Peptide
Shipping And Storage: Shipped At Room Temperature. The Product As Supplied Can Be Stored Intact At Room Temperature For Several Weeks. For Longer Periods, It Should Be Stored At -20°C.
Storage Of Solutions: Up To Two Weeks At 4°C Or Three Months At -20°C.

APPLICATION OF APETX2

APETx2, A Peptide Toxin Effector Of ASIC3, Is A 42-amino-acid Peptide Cross-linked By Three Disulfide Bridges.

As A Leader Of Peptide Pharmaceutical Companies, We Are Committed To Breaking The Key Technical Barriers In Peptide Drug R & D, Building An Internationally Competitive One-stop Preclinical R&D Service Platform Around Peptide Drugs By Focusing On Preclinical Pharmacokinetics, Pharmacological Efficacy, And Safety Evaluation Research.
More Information About Our Peptide Synthetic Route, Contact Us.