Cosmetic Packaging Refers To Packaging Materials Used To Pack Cosmetic Contents. According To The Material, It Can Be Divided Into 5 Categories: Plastic, Glass, Metal, Paper And Wood Products. The Production Process Of Plastic Products Includes Inje ...Read More



 SELL PRODUCT
 EXPIRE ON: 24-10-2023



 119

Overview The Single Glass Window Consists Of An Aluminum Frame And A Single Layer Of Tempered Glass. Due To The Transparent Properties Of Glass, It Is Usually Used As An Observation Window. Because There Is Only One Layer Of Glass, The Thermal Insul ...Read More



 SELL PRODUCT
 EXPIRE ON: 19-07-2023



 147

Nanosox Air Dispersion System Is A Flexible Terminal Air Dispersion System For The HVAC/R Industry. The Fabric Air Ventilation System Is Made Of Special High-tech Fabric, Replacing Traditional Air Ducts, Air Dampers, Diffusers, And Thermal Insulation ...Read More



 SELL PRODUCT
 EXPIRE ON: 18-07-2023



 84

RETURNSOX™-N SERIES/I SERIES Made Of High-strength Material, ReturnSox™ Utilize Patented Internal Support Frame To Maintain The Flexible Air Duct In Rectangle Shape And Return Air Under Negative Pressure. Returnsox™ Is A Replacement Of Tradi ...Read More



 SELL PRODUCT
 EXPIRE ON: 12-07-2023



 114

Led Tree Light Lamp Are One Of The Lights That Is Different From The Usage, Purpose, And Application Of Other Normal Lights. It Can Be Used On Many Occasions, For Example, You Are Able To Use Special Lights To Decorate The Stage And Enhance The Illum ...Read More



 SELL PRODUCT
 EXPIRE ON: 24-06-2023



 117

Durkeesox Integrate And Streamline Its Production Procedures In The Factory,leaving The Installation Work That On-site Worker Can Easily Manage Well.That Contributes To Easier Installation,lower Cost And Shorter Construction Time Compared With That O ...Read More



 SELL PRODUCT
 EXPIRE ON: 20-06-2023



 67

With The Rapid Development Of Society, People's Life Is Getting Better And Better. Many Kinds Of Technology Panels Have Been Invented, And The Wood Grain Aluminum Composite Panel Is One Of Them. The Wood Grain Aluminium Composite Panel Is A Kind Of A ...Read More



 SELL PRODUCT
 EXPIRE ON: 20-06-2023



 117

FEEJOY Magnetic Level Gauge Is Usually Used For Medium Level Detection Of Various Towers, Tanks, Spherical Vessels And Boilers. FEEJOY Magnetic Level Gauge Is The Most Advanced, Accurate And Reliable Liquid Level Measurement System. This magnetic Typ ...Read More



 SELL PRODUCT
 EXPIRE ON: 29-03-2023



 100

Features F 800 Mud Pump For Oil Drilling Have Features Of Solid And Compact Structure, Small Volume, Good And Reliable Performance. It Can Meet The Drilling Requirements Such As High Pressure And Big Displacements Whether In Land Drilling Or Off-sho ...Read More



 SELL PRODUCT
 EXPIRE ON: 16-03-2023



 144

ASIC3 Channels, APETx2 Inhibits ASIC3 Channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAT.#: O1040-V CAS N0.: 713544-47-9 Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide Bonds Between Cys4-Cys37, Cys6-Cys30 And Cys20-Cy ...Read More



 SELL PRODUCT
 EXPIRE ON: 31-12-2022



 100

X Ray Component Counter, Also Known As SMD Components Counter. The Equipment Adopts The Principle Of Photoelectric Sensing And Uses The Corresponding Relationship Between The Guide Hole Of The Carrier And The Components To Accurately Determine The Nu ...Read More



 SELL PRODUCT
 EXPIRE ON: 24-11-2022



 91

XB8200 Is Mainly Used For Automatic Online Detection Of Positive And Negative Alignment During The Production Of Square Polymer Soft Pack Batteries. The battery X Ray Inspection System Is Based On The Fully Automatic Optical Detection Developed O ...Read More



 SELL PRODUCT
 EXPIRE ON: 06-09-2022



 91

In The Inspection Process Of Electronic Components, The PCB X Ray Inspection Equipment Can Be Directly Connected To The SMT Production Line For High-capacity Automatic Online Full Inspection, It Can Be Used Offline With Unloader And Loader. PCB ...Read More



 SELL PRODUCT
 EXPIRE ON: 30-06-2022



 87

XB8100 SMT AOI Machine Is Mainly Used For Automatic Online Detection Of Positive And Negative Alignment During The Production Of Cylindrical 18650 Batteries. This AOI automated Optical Inspection Equipment Is Based On The Fully Automatic Optical ...Read More



 SELL PRODUCT
 EXPIRE ON: 16-06-2022



 81

XB8100 SMT AOI Machine Is Mainly Used For Automatic Online Detection Of Positive And Negative Alignment During The Production Of Cylindrical 18650 Batteries. This AOI automated Optical Inspection Equipment Is Based On The Fully Automatic Optical ...Read More



 SELL PRODUCT
 EXPIRE ON: 16-06-2022



 17

Fig 1002 Hammer Union Working Pressure: 10,000psi (690 Bar) Through 4-inch Sizes; 7,500 Psi (517bar), 5-and 6-inch Sizes Features: Replaceable,lip-type Seal Provides Primary Seal,protects Secondary Metal-to-metal,and Minimizes Flow Turbulen ...Read More



 BUY PRODUCT
 EXPIRE ON: 18-05-2022



 135

Product Introduction We Provide Wireless Temperature Sensor Only Or Iot Temperature And Humidity Sensor, Which Consists Of The Temperature Probe Or Temperature & Humidity Probe, Data Logger (Wi-Fi/GPRS/LTE) And Antenna Of The Corresponding Frequency ...Read More



 SELL PRODUCT
 EXPIRE ON: 05-05-2022



 159

Laser Cutting Sheet Is Used Successfully In A Wide Variety Of Industries. Cutting Materials With High Power Density Laser Beam. The Thickness Of The Plate Which Can Be Processed In The Range Of Cold Bonding Plate And Hot Bonding Plate Should Be Less ...Read More



 BUY PRODUCT
 EXPIRE ON: 14-04-2022



 163