Chemicals in China

Classification: Pharmaceutical Cas NO.: 76-22-2 Molecular Formula: C10H16O Melting Point: 175-177 °C(it.) Boiling Point: 204 °C(lit) Stbilty: Stable. Combustible. Incompatible With Strong Oxidizing Agents, Metallic Salts, Combustible Material ...Read More

Highly Cost-effective, Injection Grade, Product Quality In Line With ChP, USP, JP, EP Standards, Registered In US FDA, DMF No.034401 And 035566). SPECIFICATIONS OF D(+)-TREHALOSE DIHYDRATE (FOR INJECTION) Product Name D(+)-Trehalose Dihydrate (Fo ...Read More

Classification: Pharmaceutical Cas NO.: 117704-25-3 Molecular Formula: C50H74O14 Melting Point: 116- 119 C Boiling Point 967.4 °C At 760 MmHg Stability:. Null Refractive Index:1 .579 Flash Point: 967.4 °C At 760 MmHg Purity: 99% Appearanc ...Read More

Commodity Name: Calcium Dodecylbenzene Sulfonate  Calcium Salt Linear Alkylbenzene Sulfonate Calcium Linear And Branched Calcium Dodecylbenzene Sulphonate Linear Dodecylbenzene Sulphonate, Calcium Salt In 2-ethyl Hexanol Chemical Compositi ...Read More

The Resin Method Has Certain Advantages In Removing Low-concentration Zinc-containing Wastewater From Solution. When Zinc-containing Wastewater Passes Through The Ion Exchange Resin, The Ions On The Exchanger Are Exchanged With The Zinc Ions In The W ...Read More

Hubei Aulice Tyre Co., Ltd Is A Collection Of Research, Design, Production And Sales Process All-in-one Tyre Manufacturing Industry Since 1998. With Latest Established Plant Of All-steel Radial Truck Tyre In 2012, We Strive To Meet The Growing Demand ...Read More

Tromethamine Tris Buffer Is A Buffer Salt Widely Used In The Field Of Biomedicine. AVT Has Newly Launched Tromethamine (TRIS). NMPA And US FDA Registration In Progress. The Product Advantages Including High Purity, Low Impurities, Production In Accor ...Read More

Classification: Pharmaceutical Cas NO.: 38194-50-2 Molecular Formula: C20H17FO3S ; Melting Point: 182-185°C Boiling Point: 581.6 °C At 760 MmHg Stability:. Stable At Normal Temperatures And Pressures. Refractive Index:1.672 Flash Point: 305. ...Read More

The Last Price Cut Before The Spring Festival, If Needed To Seize The Opportunity. The Last Price Cut Before The Spring Festival, If Needed To Seize The Opportunity. If You Want To Know Any Details, Please Click On Our €�products & Services” Page. ...Read More

Gomez Chemical Is A China Factory that Produce Cellulose HPMC/ HEMC/ HEC and RDP for Many Years. We Provide construction-grade chemical Products, It's A Good Match For Your Business. We Are A Professional Manufacturer Of Cellulose Ether ...Read More

Gomez Chemical Is A China Factory that Produce Cellulose HPMC/ HEMC/ HEC and RDP for Many Years. We Provide construction-grade chemical Products, It's A Good Match For Your Business. We Are A Professional Manufacturer Of Cellulose Ether ...Read More

Gomez Chemical Is A China Factory that Produce Cellulose HPMC/ HEMC/ HEC and RDP for Many Years. We Provide construction-grade chemical Products, It's A Good Match For Your Business. We Are A Professional Manufacturer Of Cellulose Ether ...Read More

ASIC3 Channels, APETx2 Inhibits ASIC3 Channels1 SPECIFICATION OF APETX2 Product Name: APETx2 CAT.#: O1040-V CAS N0.: 713544-47-9 Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide Bonds Between Cys4-Cys37, Cys6-Cys30 And Cys20-Cy ...Read More

Peptide Api, Peptide Apis The Biological Activity Of Peptide Is Extensive And Important, And It Can Act On Endocrine System, Digestive System, Cardiovascular System And So On. Although The History Of Peptide As Pharmaceuticals Is Relatively Short, I ...Read More

L-type Ca2+ Channels. Calcicludine Is A Potent And Specific Antagonist Of Neuronal L-type CaV Channels1. SPECIFICATION OF CALCICLUDINE Product Name: Calcicludine (Calcicludine, L-type Ca2+ Channel Blocker) CAT.#: C1020-V CAS N0.: 178037-96-2 ...Read More

Potent, Specific L-type Ca2+ Channel Blocker (IC50 = 15 NM). Inactive On Other Voltage-dependent Ca2+ Channels. Smooth Muscle Relaxant And Cardiac Contraction Inhibitor. Neurotoxic. Active In Vivo And In Vitro. SPECIFICATION OF CALCISEPTINE Pro ...Read More

Xanthan Gum In Food Applications Do You Know The Uses Of Xanthan Gum In The Food Industry? Food Grade Xanthan Gum, Also Known As E415 Food Additive, Xanthan Gum E 415, Thickener/stabilizer E415, Can Be Used In Milk Drinks, Yogurt, Sausage, Cans, Fro ...Read More

Do You Know The Uses Of Xanthan Gum In The Food Industry? Food Grade Xanthan Gum, Also Known As E415 Additive, Xanthan Gum E 415, Thickener/stabilizer E415, Can Be Used In Milk Drinks, Yogurt, Sausage, Cans, Frozen Food, Juices, And Juice-containing ...Read More