Pressure:150LB-1200LB Size:DN15-DN2500 Design Std:API,DIN,GB,JIS,BS Product Material:CAST-IRON,ASTM A216 WCB,A351 CF8,A351 CF8M http://www.fsbic.c ...
Explore More



 570

Swing, Cast Steel Check Valve 150Lb/300Lb/600Lb/900Lb (size:½"-48") http://www.fsbic.com
Explore More



 518

Wafer Cast Steel Check Valve150Lb/300Lb/600Lb/900Lb (size:½"-30") http://www.fsbic.com
Explore More



 536

Forged Steel Gate Valve 800/Lb900/Lb1500Lb http://www.fsbic.com
Explore More



 512

Size:"1-13/16","2-1/16","2-9/16","3-1/8","3-1/16","4-1/16","5-1/8","7-1/16" PN: 5000psi,10000psi,15000psi,20000psi,2000psi,3000psi Material: 4130,ra ...
Explore More



 553

Design Features: Outside Stem & Yoke Rising stem Flat-Plate Disc Fully piggable Soft or High Performance Sealing Firesafe Design Block and b ...
Explore More



 520

08A Chrome Acorn Wheel Lug Nuts With ThreadSize 7/16 , 1/2 , M12 , M14 QuickDetail: Type: AcornLugNuts ModelNumber: 1002 Size: Light-35mm,H ...
Explore More



 348

Auto wheel Anti - theft Nut And Bolt Kit,for 6 point nuts Description: XIANGHEisoneofbestsuppliersinafter-marketwheelaccessorie,whichi ...
Explore More



 307

17mm hex High Tensile wheel lug bolt with cone seat QuickDetail: Type: WheelLugBolts ModelNumber: 18120 Hex: 17mm Length:60mm Thread ...
Explore More



 309

Grade 10.9 Truck Wheel Nuts , 99mm length bolt , M18 x 1 . 5 Description: XIANGHEisoneofbestsuppliersinafter-marketwheelacces ...
Explore More



 296

QuickDetail: 1, Type: Wheelbalanceweight 2, ModelNumber: XHZ01 3, Material: Zn 4, Size: 3.8mmthickness 5, Spe.: (5g+10g)*4 6, Sur ...
Explore More



 292

QuickDetail: Type: TireValve ModelNumber: TR413C Size: Standard Material: 100%NaturalRubber Color: Yellow,Purple,Red,Blue,Green R ...
Explore More



 290

QuickDetail: Type: wheelhubring Material: Aluminum/Plastic Color:Black,Grey,Yellow,White,Sliver O.D.=72.64/73mm I.D.=54.06-70.10mm ...
Explore More



 335

QuickDetail: 1, Type: WheelSpacers 2, Material: AluminumAlloy 3, Application: 5Lug,4.5-5BC 4, Surface: PlatedChrome 5, Thickness: 5 ...
Explore More



 310

T - handle reamer auto Tire Repair Tool for tubeless tire Description: Tirerepairtoolsisspecialistinthemending,tousewiththetireseal,fasta ...
Explore More



 291

Universal Aluminum Wheel Hub Centric Rings QuickDetail: Type: wheelhubring Material: Aluminum/Plastic Color:Black,Grey,Yellow,White,Sliv ...
Explore More



 280

Aluminum Wheel Nut/wheel Lock Nuts For Racing Car M12x1.5 Description: XIANGHE is one of best suppliers in after-market wheel accessorie, ...
Explore More



 296

Length 35 mm Wheel Lock Nuts With Washer Description: XIANGHE is one of best suppliers in after-market wheel accessorie, which is a profe ...
Explore More



 296